PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g03565.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family FAR1
Protein Properties Length: 469aa    MW: 54131 Da    PI: 9.4755
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g03565.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR137.39.2e-1219783090
              FAR1 30 krtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90
                      ++t +C+++gk +++ ++  k++r ra++++gCka++ vk++ dg  ++++++ eHnH+l+
  Bradi5g03565.1.p 19 NATHTCTRKGKYTTSVHD-GKRQRGRASKKIGCKAHMGVKMNADGGCVIKRIHFEHNHQLT 78
                      57889*********9999.9999************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031017.5E-92078IPR004330FAR1 DNA binding domain
PfamPF105512.6E-9200247IPR018289MULE transposase domain
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
MSHLPIPSIF GKVLLQPNNA THTCTRKGKY TTSVHDGKRQ RGRASKKIGC KAHMGVKMNA  60
DGGCVIKRIH FEHNHQLTLS PSMLVFLHSH KRVNPTLQDY IKDLQLSTVK HVNIMSFLTR  120
LSGGRDKLGC HNRDVLNMKA KNARKESAHD VQKLFKFFDD MTAENENFYY DVHVGEDNRL  180
NNIFWANASC RVAYADFGDC ITFDTTYKSN KFHLPLAVFV GLSNHLLSSI FGVALMGDES  240
VDSFKWYQCP SMATAIPQIF PRSLHKLCRW HIMRKHKDSL GKLYKLFPDL KDQLPAVLNH  300
PLMPTEFEAA WHELVNKYNL HDVNVMVNLW NERKTWIFAY WKDVLCACMT STQRSESMNH  360
VLKNGFVREQ HDLHIFAQQV NNCIQTRHES EAAEAIASMG VMKPLTRYGF DAQILEHYTR  420
AVYGVFRERQ FHSTGFRIKT SSQNTTEFLV HHYNQSREFA WSSHEFHL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLI1IWB00.0I1IWB0_BRADI; Uncharacterized protein
STRINGBRADI5G03570.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1640124
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.13e-60FAR1-related sequence 5